Rabbit anti-Human AGTR2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00337P

• Product Name:
• Rabbit anti-Human AGTR2 Polyclonal Antibody

• Synonym:
• AT2; ATGR2; MRX88; AGTR2

• Description:
• The antibody against AGTR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human AGTR2 (NP_000677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human AGTR2 (NP_000677.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• AGTR2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCR

• Gene ID:
• 186

• Uniprot-ID:
• P50052

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549