Rabbit anti-Human AGR2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11781P

• Product Name:
• Rabbit anti-Human AGR2 Polyclonal Antibody

• Synonym:
• AG2; AG-2; HPC8; GOB-4; HAG-2; RIFTD; XAG-2; PDIA17; HEL-S-116; AGR2

• Description:
• The antibody against AGR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-175 of human AGR2 (NP_006399.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-175 of human AGR2 (NP_006399.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• AGR2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

• Gene ID:
• 10551

• Uniprot-ID:
• O95994

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, BT-474, MCF7, NCI-H460, Mouse stomach, Mouse liver, Mouse small intestine, Rat lung