Rabbit anti-Human Activator protein 2 (AP-2/TFAP2A) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12211P

• Product Name:
• Rabbit anti-Human Activator protein 2 (AP-2/TFAP2A) Polyclonal Antibody

• Synonym:
• AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; Activator protein 2 (AP-2/TFAP2A)

• Description:
• The antibody against Activator protein 2 (AP-2/TFAP2A) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Activator protein 2 (AP-2/TFAP2A)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNL

• Gene ID:
• 7020

• Uniprot-ID:
• P05549

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa