Rabbit anti-Human ACSM1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08332P

• Product Name:
• Rabbit anti-Human ACSM1 Polyclonal Antibody

• Synonym:
• BUCS1; MACS1

• Description:
• The antibody against ACSM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACSM1(NP_443188.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACSM1(NP_443188.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ACSM1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ILYRLQLSKAKGIVTIDALASEVDSIASQCPSLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPG

• Gene ID:
• 116285

• Uniprot-ID:
• Q08AH1

• Purification Method:
• Affinity purification