Rabbit anti-Human ACAC1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08467P

• Product Name:
• Rabbit anti-Human ACAC1 Polyclonal Antibody

• Synonym:
• ACC; ACAC; ACC1; ACCA; Acac1; hACC1; ACACAD; ACCalpha; ACACalpha; acetyl-ACC1

• Description:
• The antibody against ACAC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-75 of human ACAC1 (NP_942133.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-75 of human ACAC1 (NP_942133.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ACAC1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHI

• Gene ID:
• 31

• Uniprot-ID:
• Q13085

• Purification Method:
• Affinity purification