Rabbit anti-Human ABHD6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08097P

• Product Name:
• Rabbit anti-Human ABHD6 Polyclonal Antibody

• Synonym:
• AA673485; AV065425; 0610041D24Rik; ABHD6

• Description:
• The antibody against ABHD6 was raised in Rabbit using the recombinant protein of human ABHD6 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human ABHD6.

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ABHD6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RYAHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYSTDNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEVLENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN

• Gene ID:
• 57406

• Uniprot-ID:
• Q9BV23

• Purification Method:
• Affinity purification

• Positive Samples:
• C2C12, RAW264.7, C6