Rabbit anti-Human ABCG2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08066P

• Product Name:
• Rabbit anti-Human ABCG2 Polyclonal Antibody

• Synonym:
• MRX; MXR; ABCP; BCRP; BMDP; MXR1; ABC15; BCRP1; CD338; GOUT1; MXR-1; CDw338; CDw388; UAQTL1; EST157481; [KD Validated] ABCG2

• Description:
• The antibody against ABCG2 was raised in Rabbit using the recombinant protein of human ABCG2 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human ABCG2.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ABCG2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL

• Gene ID:
• 9429

• Uniprot-ID:
• Q9UNQ0

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, A-549, MCF7