Rabbit anti-Human ABCD4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06915P

• Product Name:
• Rabbit anti-Human ABCD4 Polyclonal Antibody

• Synonym:
• P70R; P79R; ABC41; MAHCJ; PMP69; PXMP1L; EST352188; ABCD4

• Description:
• The antibody against ABCD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human ABCD4 (NP_005041.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human ABCD4 (NP_005041.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ABCD4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DQFTCNLLYVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQLSSMASKLIISPFTLVYYTYQCFQSTGWLGPVSIFGYFILGTVVNKTLMGPIVMKLVHQEKLEGDFRFKHMQIRVNAEPAAFYRAGHVEHMRTDRRLQRLLQTQRELMSKELWLYIGINTFDYL

• Gene ID:
• 5826

• Uniprot-ID:
• O14678

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7