Rabbit anti-Human ABCB4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08909P

• Product Name:
• Rabbit anti-Human ABCB4 Polyclonal Antibody

• Synonym:
• GBD1; ICP3; MDR2; MDR3; PGY3; ABC21; MDR2/3; PFIC-3; ABCB4

• Description:
• The antibody against ABCB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ABCB4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILE

• Gene ID:
• 5244

• Uniprot-ID:
• P21439

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain