Rabbit anti-Human βIII-Tubulin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-16747P

• Product Name:
• Rabbit anti-Human βIII-Tubulin Polyclonal Antibody

• Synonym:
• CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; in

• Description:
• The antibody against βIII-Tubulin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human βIII-Tubulin/β3-Tubulin. (NP_006077.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human βIII-Tubulin/β3-Tubulin. (NP_006077.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• βIII-Tubulin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF

• Gene ID:
• 10381

• Uniprot-ID:
• Q13509

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, MCF7, mouse brain, mouse testis, rat brain, rat testis