Rabbit anti-Human β-Tubulin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11507P

• Product Name:
• Rabbit anti-Human β-Tubulin Polyclonal Antibody

• Synonym:
• M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56; β-Tubulin

• Description:
• The antibody against β-Tubulin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human β-Tubulin (NP_006077.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human β-Tubulin (NP_006077.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• β-Tubulin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF

• Gene ID:
• 203068

• Uniprot-ID:
• P07437

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, MCF7, COS-1, NIH/3T3, Mouse spleen, Mouse brain