Rabbit anti-Human γ-Tubulin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03135P

• Product Name:
• Rabbit anti-Human γ-Tubulin Polyclonal Antibody

• Synonym:
• TUBG; GCP-1; CDCBM4; TUBGCP1; γ-Tubulin

• Description:
• The antibody against γ-Tubulin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 382-451 of human γ-Tubulin (NP_001061.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 382-451 of human γ-Tubulin (NP_001061.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• γ-Tubulin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

• Gene ID:
• 7283

• Uniprot-ID:
• P23258

• Purification Method:
• Affinity purification

• Positive Samples:
• U2OS, HeLa, NIH/3T3, C2C12, Jurkat, C6, Mouse brain