Rabbit anti-Human β-Catenin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12797P

• Product Name:
• Rabbit anti-Human β-Catenin Polyclonal Antibody

• Synonym:
• EVR7; CTNNB; MRD19; NEDSDV; armadillo; β-Catenin

• Description:
• The antibody against β-Catenin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 667-781 of human β-Catenin (NP_001895.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 667-781 of human β-Catenin (NP_001895.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• β-Catenin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

• Gene ID:
• 1499

• Uniprot-ID:
• P35222

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Mouse lung, C6