Rabbit anti-Human 14-3-3 epsilon Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09103P

• Product Name:
• Rabbit anti-Human 14-3-3 epsilon Polyclonal Antibody

• Synonym:
• MDS; HEL2; MDCR; KCIP-1; 14-3-3E; 14-3-3 epsilon

• Description:
• The antibody against 14-3-3 epsilon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• 14-3-3 epsilon

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL

• Gene ID:
• 7531

• Uniprot-ID:
• P62258

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, U-251MG, Mouse brain, Mouse kidney, Mouse lung, Rat brain, Rat kidney, Rat lung