• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human 14-3-3 epsilon Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-09103P
  • Product Name:
  • Rabbit anti-Human 14-3-3 epsilon Polyclonal Antibody
  • Synonym:
  • MDS; HEL2; MDCR; KCIP-1; 14-3-3E; 14-3-3 epsilon
  • Description:
  • The antibody against 14-3-3 epsilon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, IF/ICC, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • 14-3-3 epsilon
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL
  • Gene ID:
  • 7531
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • HeLa, 293T, U-251MG, Mouse brain, Mouse kidney, Mouse lung, Rat brain, Rat kidney, Rat lung
  • Pre product:Rabbit anti-Human GPR143 Polyclonal Antibody-ADA-09102P
  • Online Inquiry

    refresh