Rabbit anti- XCP1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08034P

• Product Name:
• Rabbit anti- XCP1 Polyclonal Antibody

• Synonym:
• IDP105; GRMZM2G066326; XCP1; Cysteine protease5

• Description:
• The antibody against XCP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 157-377 of maize XCP1(NP_001149806.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 157-377 of maize XCP1(NP_001149806.1).

• Species Reactivity:
• Maize

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• XCP1

• Form:
• Liquid

• Immunogen Sequence:
• EVPASVDWRKKGAVTEVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQQLVDCSTDGNNGCSGGVMDNAFSFIATGAGLRSEEAYPYLMEEGDCDDRARDGEVLVTISGYEDVPANDEQALVKALAHQPVSVAIEASGRHFQFYSGGVFDGPCGSELDHGVAAVGYGSSKGQDYIIVKNSWGTHWGEKGYIRMKRGTGKPEGLCGINKMASYPTKDH

• Gene ID:
• 100283433

• Uniprot-ID:
• B6TIC7

• Purification Method:
• Affinity purification

• Positive Samples:
• B73-329