Rabbit anti- TP53BP2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10141P

• Product Name:
• Rabbit anti- TP53BP2 Polyclonal Antibody

• Synonym:
• BBP; 53BP2; ASPP2; P53BP2; PPP1R13A; TP53BP2

• Description:
• The antibody against TP53BP2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 200-330 of TP53BP2 (NP_001026855.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 200-330 of TP53BP2 (NP_001026855.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TP53BP2

• Form:
• Liquid

• Immunogen Sequence:
• RALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKEN

• Gene ID:
• 7159

• Uniprot-ID:
• Q13625

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat