Rabbit anti- TIFY11B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07654P

• Product Name:
• Rabbit anti- TIFY11B Polyclonal Antibody

• Synonym:
• jasmonate-zim-domain protein 6; T10D10.8; T10D10_8; TIFY DOMAIN PROTEIN 11B; TIFY11B

• Description:
• The antibody against TIFY11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-269 of arabidopsis thaliana TIFY11B (NP_565043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 170-269 of arabidopsis thaliana TIFY11B (NP_565043.1).

• Species Reactivity:
• Arabidopsis thaliana

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TIFY11B

• Form:
• Liquid

• Immunogen Sequence:
• NNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL

• Gene ID:
• 843577

• Uniprot-ID:
• Q9C9E3

• Purification Method:
• Affinity purification

• Positive Samples:
• Seedling, Inflorescences, Before inflorescence, Rosette leaf