Rabbit anti- RGL2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07976P

• Product Name:
• Rabbit anti- RGL2 Polyclonal Antibody

• Synonym:
• RGA-like 2; T21P5.13; T21P5_13; RGL2

• Description:
• The antibody against RGL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-156 of arabidopsis thaliana RGL2 (NP_186995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 40-156 of arabidopsis thaliana RGL2 (NP_186995.1).

• Species Reactivity:
• Arabidopsis thaliana

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RGL2

• Form:
• Liquid

• Immunogen Sequence:
• SNMDDELLAVLGYKVRSSEMAEVAQKLEQLEMVLSNDDVGSTVLNDSVHYNPSDLSNWVESMLSELNNPASSDLDTTRSCVDRSEYDLRAIPGLSAFPKEEEVFDEEASSKRIRLGS

• Gene ID:
• 821251

• Uniprot-ID:
• Q8GXW1

• Purification Method:
• Affinity purification

• Positive Samples:
• Seedling, Inflorescences, Before inflorescence, Rosette leaf