Rabbit anti- NLRP3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08348P

• Product Name:
• Rabbit anti- NLRP3 Polyclonal Antibody

• Synonym:
• NLRP3; AGTAVPRL; AII; AVP; C1orf7; CIAS1; CLR1.1; FCAS; FCAS1; FCU; MWS; NALP3; PYPAF1; NLR family pyrin domain containing 3

• Description:
• The antibody against NLRP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 930-1036 human NLRP3(NP_004886.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 930-1036 human NLRP3(NP_004886.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NLRP3

• Form:
• Liquid

• Immunogen Sequence:
• KLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

• Gene ID:
• 114548

• Uniprot-ID:
• Q96P20

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1