Rabbit anti- Med25 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07164P

• Product Name:
• Rabbit anti- Med25 Polyclonal Antibody

• Synonym:
• F2J7.4; F2J7_4; MED25; mediator 25; PHYTOCHROME AND FLOWERING TIME 1; Med25

• Description:
• The antibody against Med25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3).

• Species Reactivity:
• Arabidopsis thaliana

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Med25

• Form:
• Liquid

• Immunogen Sequence:
• AGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTV

• Gene ID:
• 839141

• Uniprot-ID:
• Q7XYY2

• Purification Method:
• Affinity purification

• Positive Samples:
• Seedling, Inflorescences, Before inflorescence, Rosette leaf