Rabbit anti- Lumican (LUM) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03820P

• Product Name:
• Rabbit anti- Lumican (LUM) Polyclonal Antibody

• Synonym:
• LDC; SLRR2D; Lumican (LUM)

• Description:
• The antibody against Lumican (LUM) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-338 of Lumican (LUM) (NP_002336.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-338 of Lumican (LUM) (NP_002336.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Lumican (LUM)

• Form:
• Liquid

• Immunogen Sequence:
• QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

• Gene ID:
• 4060

• Uniprot-ID:
• P51884

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, HepG2, Mouse heart, Mouse lung, Rat heart, Rat lung