Rabbit anti- LGR5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08217P

• Product Name:
• Rabbit anti- LGR5 Polyclonal Antibody

• Synonym:
• FEX; HG38; GPR49; GPR67; GRP49; LGR5

• Description:
• The antibody against LGR5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 480-580 of human LGR5 (NP_003658.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 480-580 of human LGR5 (NP_003658.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LGR5

• Form:
• Liquid

• Immunogen Sequence:
• CAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTS

• Gene ID:
• 8549

• Uniprot-ID:
• O75473

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain