• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti- HNF1B Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-04186P
  • Product Name:
  • Rabbit anti- HNF1B Polyclonal Antibody
  • Synonym:
  • T2D; FJHN; HNF2; LFB3; RCAD; TCF2; HPC11; LF-B3; MODY5; TCF-2; VHNF1; ADTKD3; HNF-1B; HNF1beta; HNF-1-beta; HNF1B
  • Description:
  • The antibody against HNF1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of HNF1B (NP_000449.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of HNF1B (NP_000449.1).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • HNF1B
  • Form:
  • Liquid
  • Immunogen Sequence:
  • MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSS
  • Gene ID:
  • 6928
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • HepG2, Mouse liver, Rat liver
  • Pre product:Rabbit anti-Human TGIF1 Polyclonal Antibody-ADA-04185P
  • Online Inquiry

    refresh