Rabbit anti- HDAC10 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10663P

• Product Name:
• Rabbit anti- HDAC10 Polyclonal Antibody

• Synonym:
• HD10; [KD Validated] HDAC10

• Description:
• The antibody against HDAC10 was raised in Rabbit using a synthesized peptide derived from human HDAC10 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthesized peptide derived from human HDAC10.

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HDAC10

• Form:
• Liquid

• Immunogen Sequence:
• DQPCLCPAPSVRTAVALTTPDITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGLAGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCHPHLVA

• Gene ID:
• 83933

• Uniprot-ID:
• Q969S8

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, 293T(KD)