Rabbit anti- GPX4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12920P

• Product Name:
• Rabbit anti- GPX4 Polyclonal Antibody

• Synonym:
• MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx

• Description:
• The antibody against GPX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of GPX4 (NP_002076.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of GPX4 (NP_002076.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GPX4

• Form:
• Liquid

• Immunogen Sequence:
• ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

• Gene ID:
• 2879

• Uniprot-ID:
• P36969

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat