Rabbit anti- Chk1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07670P

• Product Name:
• Rabbit anti- Chk1 Polyclonal Antibody

• Synonym:
• CHK1; Chk1

• Description:
• The antibody against Chk1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 148-307 of Chk1 (NP_001265.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 148-307 of Chk1 (NP_001265.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Chk1

• Form:
• Liquid

• Immunogen Sequence:
• DFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSAS

• Gene ID:
• 1111

• Uniprot-ID:
• O14757

• Purification Method:
• Affinity purification

• Positive Samples:
• A-431, 293T