Rabbit anti- BOB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08221P

• Product Name:
• Rabbit anti- BOB1 Polyclonal Antibody

• Synonym:
• POU2AF1; BOB1; OBF-1; OBF1; OCAB; POU class 2 associating factor 1

• Description:
• The antibody against BOB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human BOB1(NP_006226.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human BOB1(NP_006226.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BOB1

• Form:
• Liquid

• Immunogen Sequence:
• NVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHT

• Gene ID:
• 5450

• Uniprot-ID:
• Q16633

• Purification Method:
• Affinity purification

• Positive Samples:
• Daudi