Rabbit anti- Albumin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08052P

• Product Name:
• Rabbit anti- Albumin Polyclonal Antibody

• Description:
• The antibody against Albumin was raised in Rabbit using the recombinant protein of bovine Albumin as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of bovine Albumin.

• Species Reactivity:
• Human, Mouse, Rat, Cow

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Albumin

• Form:
• Liquid

• Immunogen Sequence:
• KVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC

• Gene ID:
• 280717

• Uniprot-ID:
• P02769

• Purification Method:
• Affinity purification

• Positive Samples:
• U-937, HepG2