Rabbit anti-Rat GM-CSF Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15765P

• Product Name:
• Rabbit anti-Rat GM-CSF Monoclonal Antibody

• Synonym:
• Gmcsf; Gm-csf

• Description:
• The antibody against GM-CSF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of rat GM-CSF (NP_446304.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of rat GM-CSF (NP_446304.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GM-CSF

• Form:
• Liquid

• Immunogen Species:
• Rat

• Immunogen Sequence:
• TRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

• Gene ID:
• 116630

• Uniprot-ID:
• P48750

• Purification Method:
• Recombinant Rat GM-CSF Protein

• Positive Samples:
• Affinity purification