Rabbit anti-Mouse UCP1+UCP3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14363P

• Product Name:
• Rabbit anti-Mouse UCP1+UCP3 Monoclonal Antibody

• Synonym:
• AI385626; Slc25a7; Ucp; UCP1+UCP3

• Description:
• The antibody against UCP1+UCP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of mouse UCP1+UCP3 (P12242) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of mouse UCP1+UCP3 (P12242).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• UCP1+UCP3

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MVNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT

• Gene ID:
• 2222722229

• Uniprot-ID:
• P12242

• Purification Method:
• Mouse skeletal muscle, Mouse fat

• Positive Samples:
• Affinity purification