Rabbit anti-Mouse TNF-α Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16838P

• Product Name:
• Rabbit anti-Mouse TNF-α Monoclonal Antibody

• Synonym:
• DIF; Tnfa; TNF-a; TNFSF2; Tnlg1f; Tnfsf1a; TNFalpha; TNF-alpha; TNF-α

• Description:
• The antibody against TNF-α was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-235 of mouse TNF-α (NP_038721.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 80-235 of mouse TNF-α (NP_038721.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TNF-α

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

• Gene ID:
• 21926

• Uniprot-ID:
• P06804

• Purification Method:
• Active Recombinant Rat TNF-alpha Protein

• Positive Samples:
• Affinity purification