Rabbit anti-Mouse TET1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14489P

• Product Name:
• Rabbit anti-Mouse TET1 Monoclonal Antibody

• Synonym:
• LCX; Cxxc6; mKIAA1676; D10Ertd17e; 2510010B09Rik; TET1

• Description:
• The antibody against TET1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse Tet1 (NP_001240786.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse Tet1 (NP_001240786.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TET1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• HNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLD

• Gene ID:
• 52463

• Uniprot-ID:
• Q3URK3

• Purification Method:
• Refer to figures

• Positive Samples:
• Affinity purification