Rabbit anti-Mouse Pro-MMP9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15415P

• Product Name:
• Rabbit anti-Mouse Pro-MMP9 Monoclonal Antibody

• Synonym:
• Clg4b; Gel B; MMP-9; B/MMP9; pro-MMP-9; Pro-MMP9

• Description:
• The antibody against Pro-MMP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-107 of mouse MMP9(NP_038627.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-107 of mouse MMP9(NP_038627.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Pro-MMP9

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGR

• Gene ID:
• 17395

• Uniprot-ID:
• P41245

• Purification Method:
• Mouse Pro-MMP9 protein

• Positive Samples:
• Affinity purification