Rabbit anti-Mouse PE Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-08390P

• Product Name:
• Rabbit anti-Mouse PE Monoclonal Antibody

• Synonym:
• Nk1; Ly59; Nk-1; CD161; Ly-59; Ly55c; NK1.1; NKRP1; Nk1.2; Klrb1b; NK-RP1; Nk-1.2; Nkrp1b; Nkrp1c; ly-55c; NKRP140; NKR-P1.9

• Description:
• The antibody against PE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-271 of mouse CD161/NK1.1 (NP_001153376.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 115-271 of mouse CD161/NK1.1 (NP_001153376.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

• Storage:
• Store at 2-8℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PE

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKG ATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTEN GSCASILGDKVTPESCASDNRWICQKELNHETPSNDS

• Gene ID:
• 17059

• Uniprot-ID:
• P27814

• Positive Samples:
• Affinity purification