Rabbit anti-Mouse IL1R1/CD121a Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15769P

• Product Name:
• Rabbit anti-Mouse IL1R1/CD121a Monoclonal Antibody

• Synonym:
• IL-iR; CD121a; CD121b; IL-1R1; Il1r-1; IL-1R-1; IL-1RT1; IL-1RT-1; IL-1R-alpha

• Description:
• The antibody against IL1R1/CD121a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-338 of mouse IL1R1/CD121a (NP_032388.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-338 of mouse IL1R1/CD121a (NP_032388.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IL1R1/CD121a

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK

• Gene ID:
• 16177

• Uniprot-ID:
• P13504

• Positive Samples:
• Affinity purification