Rabbit anti-Mouse IFN-beta Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16701P

• Product Name:
• Rabbit anti-Mouse IFN-beta Monoclonal Antibody

• Synonym:
• Ifb; IFNB; If1da1; IFN-beta

• Description:
• The antibody against IFN-beta was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of mouse IFN-beta (NP_034640.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of mouse IFN-beta (NP_034640.1)

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IFN-beta

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

• Gene ID:
• 15977

• Uniprot-ID:
• P01575

• Purification Method:
• Recombinant Mouse IFN-beta Protein

• Positive Samples:
• Affinity purification