Rabbit anti-Mouse ICOS/CD278 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15442P

• Product Name:
• Rabbit anti-Mouse ICOS/CD278 Monoclonal Antibody

• Synonym:
• H4; CCLP; AILIM; CRP-1; Ly115; ICOS/CD278

• Description:
• The antibody against ICOS/CD278 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of mouse ICOS/CD278(NP_059508.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of mouse ICOS/CD278(NP_059508.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ICOS/CD278

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL

• Gene ID:
• 54167

• Uniprot-ID:
• Q9WVS0

• Purification Method:
• Transfected CHO whole cell extracts.

• Positive Samples:
• Affinity purification