Rabbit anti-Mouse H2-Ab1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15552P

• Product Name:
• Rabbit anti-Mouse H2-Ab1 Monoclonal Antibody

• Synonym:
• IAb; Ia2; Ia-2; Abeta; H-2Ab; H2-Ab; Rmcs1; I-Abeta; H2-Ab1

• Description:
• The antibody against H2-Ab1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-219 of mouse H2-Ab1（NP_996988.2） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 31-219 of mouse H2-Ab1（NP_996988.2）.

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• H2-Ab1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• ERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQ

• Gene ID:
• 14961

• Uniprot-ID:
• P06345

• Purification Method:
• Mouse thymus, Mouse heart (Low expression control)

• Positive Samples:
• Affinity purification