Rabbit anti-Mouse EPCR/CD201 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15390P

• Product Name:
• Rabbit anti-Mouse EPCR/CD201 Monoclonal Antibody

• Synonym:
• Ccca; Epcr; Ccd41; EPCR/CD201

• Description:
• The antibody against EPCR/CD201 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-210 of mouse EPCR/CD201(NP_035301.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 18-210 of mouse EPCR/CD201(NP_035301.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• EPCR/CD201

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR

• Gene ID:
• 19124

• Uniprot-ID:
• Q64695

• Purification Method:
• Mouse spleen

• Positive Samples:
• Affinity purification