Rabbit anti-Mouse Complement C3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16695P

• Product Name:
• Rabbit anti-Mouse Complement C3 Monoclonal Antibody

• Synonym:
• ASP; Plp; HSE-MSF; Complement C3

• Description:
• The antibody against Complement C3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1364-1663 of mouse Complement C3 (NP_033908.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1364-1663 of mouse Complement C3 (NP_033908.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Complement C3

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• RVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

• Gene ID:
• 12266

• Uniprot-ID:
• P01027

• Purification Method:
• Mouse liver, Rat liver, Rat lung

• Positive Samples:
• Affinity purification