Rabbit anti-Mouse CD8A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16389P

• Product Name:
• Rabbit anti-Mouse CD8A Monoclonal Antibody

• Synonym:
• Ly-2; Ly-B; Ly-35; Lyt-2; CD8A

• Description:
• The antibody against CD8A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 148-247 of mouse CD8A(NP_001074579.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 148-247 of mouse CD8A(NP_001074579.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD8A

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• KVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV

• Gene ID:
• 12525

• Uniprot-ID:
• P01731

• Purification Method:
• Mouse spleen, Mouse thymus, Mouse brain(Negative control)

• Positive Samples:
• Affinity purification