Rabbit anti-Mouse CD79b Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15758P

• Product Name:
• Rabbit anti-Mouse CD79b Monoclonal Antibody

• Synonym:
• B29; Igb; Igbeta; Ig-beta

• Description:
• The antibody against CD79b was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-158 of mouse CD79b (NP_032365.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 26-158 of mouse CD79b (NP_032365.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD79b

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

• Gene ID:
• 15985

• Uniprot-ID:
• P15530

• Purification Method:
• Mouse spleen

• Positive Samples:
• Affinity purification