Rabbit anti-Mouse CD326/EpCAM Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15753P

• Product Name:
• Rabbit anti-Mouse CD326/EpCAM Monoclonal Antibody

• Synonym:
• EGP; Ly74; gp40; CD326; EGP-2; TROP1; Egp314; Ep-CAM; EpCAM1; Tacsd1; GA733-2; Tacstd1

• Description:
• The antibody against CD326/EpCAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-266 of mouse CD326/EpCAM (NP_032558.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-266 of mouse CD326/EpCAM (NP_032558.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD326/EpCAM

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

• Gene ID:
• 17075

• Uniprot-ID:
• Q99JW5

• Purification Method:
• Mouse colon

• Positive Samples:
• Affinity purification