Rabbit anti-Mouse CD27 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15763P

• Product Name:
• Rabbit anti-Mouse CD27 Monoclonal Antibody

• Synonym:
• S152; Tp55; Tnfrsf7; CD27

• Description:
• The antibody against CD27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-182 of mouse CD27 (NP_001028298.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-182 of mouse CD27 (NP_001028298.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.5% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD27

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

• Gene ID:
• 21940

• Uniprot-ID:
• P41272

• Positive Samples:
• Affinity purification