Rabbit anti-Mouse CD147 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14602P

• Product Name:
• Rabbit anti-Mouse CD147 Monoclonal Antibody

• Synonym:
• HT-7; CD147; EMMPRIN

• Description:
• The antibody against CD147 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 141-302 of mouse CD147 (NP_033898.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 141-302 of mouse CD147 (NP_033898.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD147

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• TIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGT

• Gene ID:
• 12215

• Uniprot-ID:
• P18572

• Purification Method:
• Mouse lung, Mouse liver, Mouse heart

• Positive Samples:
• Affinity purification