Rabbit anti-Mouse CD11b Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15667P

• Product Name:
• Rabbit anti-Mouse CD11b Monoclonal Antibody

• Synonym:
• CR3; CR3A; MAC1; Cd11b; Ly-40; Mac-1; Mac-1a; CD11b/CD18; F730045J24Rik; CD11b

• Description:
• The antibody against CD11b was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 143-337 of mouse CD11b (NP_032427.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 143-337 of mouse CD11b (NP_032427.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD11b

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• ECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEG

• Gene ID:
• 16409

• Uniprot-ID:
• P05555

• Purification Method:
• Mouse spleen

• Positive Samples:
• Affinity purification