Rabbit anti-Mouse CD105/Endoglin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15735P

• Product Name:
• Rabbit anti-Mouse CD105/Endoglin Monoclonal Antibody

• Synonym:
• Endo; CD105; S-endoglin

• Description:
• The antibody against CD105/Endoglin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-581 of mouse CD105 (NP_031958.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 27-581 of mouse CD105 (NP_031958.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD105/Endoglin

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

• Gene ID:
• 13805

• Uniprot-ID:
• Q63961

• Purification Method:
• Mouse ovary、Mouse lung

• Positive Samples:
• Affinity purification