• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human ZHX2 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-13476P
  • Product Name:
  • Rabbit anti-Human ZHX2 Monoclonal Antibody
  • Synonym:
  • RAF; AFR1; ZHX2
  • Description:
  • The antibody against ZHX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human ZHX2 (Q9Y6X8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human ZHX2 (Q9Y6X8).
  • Species Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • ZHX2
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • VPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLAPTKVTQPILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPKVANPPLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVH
  • Gene ID:
  • 22882
  • Purification Method:
  • HeLa, Mouse brain
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human ALDH7A1 Monoclonal Antibody-ADA-13475P
  • Online Inquiry

    refresh