Rabbit anti-Human YTHDC1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15070P

• Product Name:
• Rabbit anti-Human YTHDC1 Monoclonal Antibody

• Synonym:
• YT521; YT521-B; [KD Validated] YTHDC1

• Description:
• The antibody against YTHDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human YTHDC1 (NP_001026902.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human YTHDC1 (NP_001026902.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• YTHDC1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVS

• Gene ID:
• 91746

• Uniprot-ID:
• Q96MU7

• Purification Method:
• K-562, U-87MG

• Positive Samples:
• Affinity purification