Rabbit anti-Human WAVE2/WASF2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16235P

• Product Name:
• Rabbit anti-Human WAVE2/WASF2 Monoclonal Antibody

• Synonym:
• IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2; WAVE2/WASF2

• Description:
• The antibody against WAVE2/WASF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• WAVE2/WASF2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD

• Gene ID:
• 10163

• Uniprot-ID:
• Q9Y6W5

• Purification Method:
• A549, K-562, Mouse testis, Mouse thymus

• Positive Samples:
• Affinity purification